PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_7A841CAD2.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 276aa    MW: 29881.2 Da    PI: 10.0096
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_7A841CAD2.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.52.7e-172368147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           rg W + Ede+l ++v+++G+ +W++Ia+++  gR++k+c++rw++ 
  Traes_4AL_7A841CAD2.1 23 RGHWRPGEDEKLRQLVEKYGPQNWNSIAEKLE-GRSGKSCRLRWFNQ 68
                           899*****************************.***********996 PP

2Myb_DNA-binding61.61.6e-1976119247
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                             ++T+eE+e+l+ a++ +G++ W++Iar+++ gRt++ +k++w+ +
  Traes_4AL_7A841CAD2.1  76 RPFTEEEEERLLAAHRVHGNK-WALIARHFP-GRTDNAVKNHWHVV 119
                            69*******************.*********.***********976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.5821869IPR017930Myb domain
SuperFamilySSF466894.12E-3022116IPR009057Homeodomain-like
SMARTSM007172.1E-142271IPR001005SANT/Myb domain
PfamPF002498.5E-172368IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.5E-272476IPR009057Homeodomain-like
CDDcd001671.71E-142667No hitNo description
PROSITE profilePS5129428.45670124IPR017930Myb domain
SMARTSM007171.9E-1674122IPR001005SANT/Myb domain
PfamPF002492.2E-1675118IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.6E-2277119IPR009057Homeodomain-like
CDDcd001671.12E-886117No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MASLSSTTNT SEGGGKPASL CPRGHWRPGE DEKLRQLVEK YGPQNWNSIA EKLEGRSGKS  60
CRLRWFNQLD PRINKRPFTE EEEERLLAAH RVHGNKWALI ARHFPGRTDN AVKNHWHVVR  120
ARRSRERCRL LAKAASSTFP SYYSGGAQLD FAGASAGSFC FGFSKPSGGG FFGSPPAAAA  180
VAPSSTPVLF NGYGASGNQS LLSRYSSYLD GGKQPAAPSS HSIAFSSPPS REALALDGRG  240
GPDHQHRKDY HVDGDEPLKT KDAPPFIDFL GVGVSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-31231237107B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJF9519100.0JF951910.1 Triticum aestivum clone TaMYB27 R2R3-MYB protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003576185.11e-96PREDICTED: transcription factor MYB44
TrEMBLW5DQK70.0W5DQK7_WHEAT; Uncharacterized protein
STRINGMLOC_13062.21e-151(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G17950.19e-58myb domain protein 52
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]